PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA26184
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 339aa    MW: 37414.4 Da    PI: 7.0723
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA26184genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.6e-3961119462
                     zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                 +lkcprCdst+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk+s
  Tp57577_TGAC_v2_mRNA26184  61 LSLKCPRCDSTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKVS 119
                                5689****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2849113IPR003851Zinc finger, Dof-type
PfamPF027011.8E-3362117IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.18963117IPR003851Zinc finger, Dof-type
PROSITE patternPS01361065101IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MGLSSLHVCN SMESSADHWL QGTIHEESGM DSSSPISGDM LTCSRPSSMI DQRRLRPPHD  60
LSLKCPRCDS THTKFCYYNN YSLSQPRYFC KTCRRYWTKG GTLRNIPVGG GCRKNKKVSN  120
KKSNDNNHHL VTSNNNNIQN QPHHVPSYHH QNPKDLQLSF PDVQFSHLSN LLGTNGALGN  180
PNFMLENPRP IDFMMESKLE GIIGSSSRSF DNFFGNGDHM SMNMGGVGIG GGDMMNGTQN  240
GLSQNFHHAF GGMSFDGGNN NSGAYLMDSC QRLMLPYDAN DDQDHNDVKP NPKLLSLEWQ  300
QDQGCSDVGK ESFGYGSWSG SMMNGYYGSS TTNPLING*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT9542361e-147CT954236.4 M.truncatula DNA sequence from clone MTH2-3H12 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003601260.20.0Dof domain zinc finger protein
TrEMBLG7J5F50.0G7J5F5_MEDTR; Dof domain zinc finger protein
STRINGGLYMA04G35650.11e-139(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50923456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.17e-42Dof family protein